Query (optional)   in Class  

GrainGenes Sequence Report: Y00966_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y00966_1.cds
Peptide
MASTNMASATSRFMLAAGIPSGANGGVSSRVSFLPSNRLGLKLVARAEEP
TAAAPAEPAPAADEKPEAAVATKEPAKAKPPPRGPKRGTKVKILRRESYW
YNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEVAA
Structure From Source
Y00966
Source Exons
1444
Corresponding Protein
Y00966_1.protseq
Remark
CDS note: unnamed protein product; psa2 preprotein (AA -46 to 101)
[ Show all 10 ]
Codon Start
1