Query (optional)   in Class  

GrainGenes Sequence Report: Y07550_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y07550_1.cds
Peptide
MHPSLQTILLSALFTTAHAQQACSSKPETHPPLSWSRCSRSGCRSVQGAV
TVDANWLWTTVDGSQNCYTGNRWDTSICSSEKTCSESCCIDGADYAGTYG
VTTTGDALSLKFVQQGPYSKNVGSRLYLMKDESRYEMFTLLGNEFTFDVD
VSKLGCGLNGALYFVSMDEDGGMKRFPMNKAGAKFGTGYCDSQCPRDVKF
INGMANSKDWIPSKSDANAGIGSLGACCREMDIWEANNIASAFTPHPCKN
SAYHSCTGDGCGGTYSKNRYSGDCDPDGCDFNSYRLGNTTFYGPGPKFTI
DTTRKISVVTQFLKGRDGSLREIKRFYVQNGKVIPNSVSRVRGVPGNSIT
QGFCNAQKKMFGAHESFNAKGGMKGMSAAVSKPMVLVMSLWDDHNSNMLW
LDSTYPTNSRQRGSKRGSCPASSGRPTDVESSAPDSTVVFSNIKFGPIGS
TFSRGK
Structure From Source
Y07550
Source Exons
1612
7391305
14251616
DB Remark
3.2.1.91
Corresponding Protein
Y07550_1.protseq
Gene
cel1
Gene Product
cellulose 1,4-beta-cellobiosidase precursor
Remark
DB_xref: GI:1906845
[ Show all 7 ]
Codon Start
1