Query (optional)   in Class  

GrainGenes Sequence Report: Y07844_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y07844_1.cds
Peptide
MSIVRRSNAFDPFADLWADPFDTFRSIVPAFSGNSETAAFANARVDWKET
PEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVER
SSGKFVRRFRLPEDAKVEEVKAGLENGVLTVTVPKTEVKKPEVKAIEISG
Structure From Source
Y07844
Source Exons
1453
Corresponding Protein
Y07844_1.protseq
Gene Product
17 kDa class I small heat shock protein
Remark
CDS note: putative
[ Show all 9 ]
Codon Start
1