Query (optional)   in Class  

GrainGenes Sequence Report: Y08308_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y08308_1.cds
Peptide
MXYIXGARSLPDEQVRIASTKMDGIGPKKAIQLRYRLGISXNIKMNELTK
YQIDQIEQMIAQDHVVHWELKRGERADIERLISISRYRGIRHQDGSPLRG
QRTHTNARTARKXXXK
Structure From Source
Y08308
Source Exons
1351
Corresponding Protein
Y08308_1.protseq
Gene Product
ribosomal protein S13
Remark
DB_xref: GI:4467407
DB_xref: SPTREMBL:Q95700
Feature: CDS: protein_id = 'CAA69616.2';
Gene: rps13
Codon Start
1