Query (optional)   in Class  

GrainGenes Sequence Report: Y08490_1.cds

[ Submit comment/correction ]

Sequence
Y08490_1.cds
Peptide
MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFN
TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAA
NNFARGHYTIGKEIVDLCLDRIRKLSDNCTGLQGFLVFNAVGGGTGSGLG
SLLLERLSVDYGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDV
SILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNV
DVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTG
FKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEFDDGEDGDEGDE
Y
Structure From Source
Y08490
Source Exons
11356
Corresponding Protein
Y08490_1.protseq
Gene Product
alpha-tubulin 2
Remark
DB_xref: GI:1619297
[ Show all 11 ]
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.