Query (optional)   in Class  

GrainGenes Sequence Report: Y09013_1.cds

[ Submit comment/correction ]

Sequence
Y09013_1.cds
Peptide
MEPVFFSLEEAMPEPDSNPCRTSSPPLEAHMLVAGLGGVGAGEVVGGCAT
NECATEWCFQKFVDEPWLLNVPTAPVANPEASTLYPNPTAEGSRKRPYDV
HEMVGPEEVIPTPPAASPVVDPVAYNAMLRRKLDAHLAAVAMLRTTRGIC
PQSSHDNGASQNSDSIQGSENHTGDVSLHQLSSSSLEPSPSDGDMEGEAQ
TIGTMHISAEKANKRKESNRDSARRSRSRKAAHAKELEEQVSLLRVANNS
LMRHLADVSHRYVNISIDNRVLKANVETLEAKVKMAEETMKRVTCTNNFP
QAMSSISSLGIPFSGSPLNGICDNPLPTQNTSLNYLPPTTTNFDVNNNYI
PEPALAFQIQDQIPSLHMQPMSCLDHHPQRMHIGIPTSAPTPQRESTTLD
STEIVNMVM
Structure From Source
Y09013
Source Exons
11230
Corresponding Protein
Y09013_1.protseq
Gene Product
transcriptional activator
Remark
DB_xref: GI:1654099
DB_xref: SPTREMBL:O04168
Feature: CDS: protein_id = 'CAA70216.1';
Gene: SPA
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.