Query (optional)   in Class  

GrainGenes Sequence Report: Y09233_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09233_1.cds
Peptide
MAAVRLKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEH
LADLKEKFQRMCDKSMIRKRHMHLTEEILIKNPKICAHMETSLDARHAIA
LVEVPKLGQGAAEKAIKEWGQPLSKITHLVFCTTSGVDMPGADYQLTKLL
GLSPTVKRLMMYQQGCFGGATVLRLAKDIAENNRGARVLVVCSEITAMAF
RGPCKSHLDSLVGHALFGDGAAAAIIGADPDQLDEQPVFQLVSASQTILP
ESEGAIDGHLTEAGLTIHLLKDVPGLISENIEQALEDAFEPLGIHNWNSI
FWIAHPGGPAILDRVEDRVGLDKKRMRASREVLSEYGNMSSASVLFVLDV
MRKSSAKDGLATTGEGKDWGVLFGFGPGLTVETLVLHSVPVPVPTAASA
Structure From Source
Y09233
Source Exons
11200
Corresponding Protein
Y09233_1.protseq
Gene Product
homoeriodictyol/eriodictyol chalcone synthase
Remark
DB_xref: GI:1669695
[ Show all 9 ]
Codon Start
1