Query (optional)   in Class  

GrainGenes Sequence Report: Y09291_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09291_1.cds
Peptide
RPPPTIPGAPVVGGLLRFLRGPIPLIRAEYARLGPVFTVPILTRRITFLI
GPDVSAHFFKSNESDMSQQEVYRFNVPTFGPGVVFDVDYQVRQEQFRFFT
EALRANKLRSYVDQMVAEAEEYFSKWGESGTVDLKYELEHLIILTASRCL
LGREVREKLFDDVSALFHDLDNGMLPISVIFPYLPIPAHRRRDQARTRLA
EIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRQTTESEVTGLLIAALFA
GQHTSSITSTWTGAYLLKFQQYFAEAVEEQKEVMKRHGDKIDHDILAEMD
VLYRCIKEALRLHPPLIMLLRQSHSDFSVTTREGKEFDIPKGHIVATSPA
FANRLPHIFKNPDSYDPDRFAAGREEDKVAGAFSYISFGGGRHGCLGEPF
AYLQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVMVNYKRRKLI
VDN
Structure From Source
Y09291
Source Exons
11362
Corresponding Protein
Y09291_1.protseq
Gene Product
obtusifoliol 14-alpha-demethylase
Remark
DB_xref: GI:1707857
[ Show all 9 ]
Codon Start
1