Query (optional)   in Class  

GrainGenes Sequence Report: Y09292_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09292_1.cds
Peptide
LIILTASRCLGREVREKLFDDVSALFHDLDNGMQPISVIFPYLPIPAHRR
RDQARTRLAEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRQTTESEVT
GLLIAALFAGQHTSSITSTWTGAYLLKFQQYFAEAVEEQKEVMKRHGDKI
DHDILAEMDVLYRCIKEALRLHPPLIMLLRQSHSDFSVTTREGKEFDIPK
GHIVATSPAFANRLPHIFKNPDSYDPDRFAAGREEDKVAGAFSYISFGGG
RHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVM
VSYKRRKLVVDN
Structure From Source
Y09292
Source Exons
1939
Corresponding Protein
Y09292_1.protseq
Gene Product
obtusifoliol 14-alpha-demethylase
Remark
DB_xref: GI:1707855
[ Show all 7 ]
Codon Start
1