Query (optional)   in Class  

GrainGenes Sequence Report: Y09602_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09602_1.cds
Peptide
MRTTTRRLPPAPAAAAVLLAALTCLLLRPAAVAAAGGHAADRIVRLPGQP
EVDFDMYSGYITVDEAAGRSLFYLLQEAPEEAQPAPLVLWLNGGPGCSSV
AYGASEELGAFRVMPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTS
SDIYTSGDNRTAHDSYAFLAAWFERFPHYKYREFYVAGESYAGHYVPELS
QLVHRSGNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRL
KDACLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNISSSSSSSS
LSRRRTRGRYPWLTGSYDPCTERYSTAYYNRRDVQTALHANVTGAMNYTW
ATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRY
SIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRP
RQALILFQQFLQGKPMPGRTTNVTVA
Structure From Source
Y09602
Source Exons
1388
4781019
11071333
23692477
27962960
Corresponding Protein
Y09602_1.protseq
Gene Product
serine carboxypeptidase II, CP-MII
Remark
DB_xref: GI:1731990
[ Show all 7 ]
Codon Start
1