Query (optional)   in Class  

GrainGenes Sequence Report: Y09603_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09603_1.cds
Peptide
MARCRRRSGCTAGAALLLLLALALSGGGGAAPQGAEVTGLPGFDGALPSK
HYAGYVTVDEGHGRNLFYYVVESERDPGKDPVVLWLNGGPGCSSFDGFVY
EHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSYSKNVS
DYETGDLKTATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHE
VVKGIQGGAKPTINFKGYMVGNGVCDTIFDGNALVPFAHGMGLISDEIYQ
QASTSCHGNYWNATDGKCDTAISKIESLISGLNIYDILEPCYHSRSIKEV
NLQNSKLPQSFKDLGTTNKPFPVRTRMLGRAWPLRAPVKAGRVPSWQEVA
SGVPCMSDEVATAWLDNAAVRSAIHAQSVSAIGPWLLCTDKLYFVHDAGS
MIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGVVDSWRPWI
TNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAFAFYSRWLAGSKL
Structure From Source
Y09603
Source Exons
11500
Corresponding Protein
Y09603_1.protseq
Gene Product
serine carboxypeptidase I, CP-MI
Remark
DB_xref: GI:1731988
[ Show all 9 ]
Codon Start
1