Query (optional)   in Class  

GrainGenes Sequence Report: Y09604_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09604_1.cds
Peptide
MVTTPRLVSLLLLLALCAAAAGALRLPPDASFPGAQAERLIRALNLLPKD
SSSSSGRHGARVGEGNEDVAPGQLLERRVTLPGLPEGVADLGHHAGYYRL
PNTHDARMFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIAN
NMSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETGVSNDLYD
FLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINL
KGFAIGNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKL
CGTNGKASCMAAYMVCNTIFNSIMKLVGTKNYYDVRKECEGKLCYDFSNL
EKFFGDKAVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDG
INVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAG
VLKSHGALSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKLKEAVPEEESS
TTSFYAAM
Structure From Source
Y09604
Source Exons
11527
Corresponding Protein
Y09604_1.protseq
Gene Product
serine carboxypeptidase III, CP-MIII
Remark
DB_xref: GI:1877219
[ Show all 9 ]
Codon Start
1