Query (optional)   in Class  

GrainGenes Sequence Report: Y09741_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y09741_1.cds
Peptide
MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVY
YNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTL
LISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECM
VLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDL
RKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVK
SSVCDIPPTGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTG
EGMDEMEFTEAESNMNDLVSEYQQYQDATADEEGEYEDEDQEAEDDM
Structure From Source
Y09741
Source Exons
11344
Corresponding Protein
Y09741_1.protseq
Gene Product
beta-tubulin 1
Remark
DB_xref: GI:1743277
[ Show all 13 ]
Codon Start
1