Query (optional)   in Class  

GrainGenes Sequence Report: A20727_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A20727_1.cds
Peptide
MAAATTTTSRPLLLSRQQAAASSLQCRLPRRPGSSLFAGQGQASTPNVRC
MAVVDTASAPAPAAA
Structure From Source
A20727
Source Exons
1194
Corresponding Protein
A20727_1.protseq
Remark
CDS note: unnamed protein product
DB_xref: GI:579225
Feature: CDS: protein_id = 'CAA01514.1';
Codon Start
1