Query (optional)   in Class  

GrainGenes Sequence Report: X01024_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X01024_1.cds
Peptide
LACEVLKERSVCILQLHYVQPSILQQLNPCKVFLQQQCSPVRMPQLIARS
QMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIVYSIFLQEQPQQSVQG
ASQPQQQLQEEQVGQCYFQQPQPQQLGQPQQVPQSVFLQPHQIAQLEATN
SIALRTLPTMCNVNVPLYDIMPFGVGTRVGV
Structure From Source
X01024
Source Exons
1546
Corresponding Protein
X01024_1.protseq
Remark
CDS note: unnamed protein product; pot. B1 hordein
[ Show all 8 ]
Codon Start
1