Query (optional)   in Class  

GrainGenes Sequence Report: Y07636_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Y07636_1.cds
Peptide
MSRTQPMDGLDVDDEEEADSPATMKVREEKEIGKQGLKKKLVKEGEGWDT
AETALKVEVHYTGTLLDGTKFDSSRDRGTPFKFKLEQGQVIKGWDQGIKT
MKKGENASLTIPPDLAYGERAPRTIPPNATLRFDVELLSWASVKDICKDG
GIFKKVLVEGQKWENPKDLDEVTVKYEARLEDGSVVSKSESIEFSVKDGY
FCPALSKAVKTMKKGEKVLLTVKPQYGFGEQGRAATEVEGAVPPNSTLHI
DLQLVSWKTLTLIGDDKRILKKVLKEGEGYERPNDGAVVRVGLIGKLDDG
TVFTKKGHEGDEPFEFKTDEEQVIQGLDTTVLTMKKGEEASARIPPEHAF
GSTETKLSSLIFAVVPPNSSVFYEVELVSFEKEKESWDLKSNSEKIEAAS
EKKDEGNAWFKMGKYAKASKRYEKAAKYIEYDSSFSEDEKKQSKAVKISI
KLNNAACKLKLKDYKEAEKICSKVLELESTNVKALYRRAQAYTELVDLEL
AELDIKKALEIDPDNREVKVAYKALKDKLREYNKRDAKFYGNMFAKWRKT
ENAAGKQEAQPMASDSTA
Structure From Source
Y07636
Source Exons
11707
DB Remark
5.2.1.8
Corresponding Protein
Y07636_1.protseq
Gene Product
peptidylprolyl isomerase
Remark
DB_xref: GI:1915960
[ Show all 10 ]
Codon Start
1